PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 321aa    MW: 36537 Da    PI: 7.7797
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600051.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.96.4e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+d+++++G+g+W+t ++  g+ R++k+c++rw +yl
   XP_009600051.1 14 KGPWTTEEDQKLIDYIQKHGSGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.91.8e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ eE+e +++++  lG++ W++Ia +++ gRt++++k++w+++
   XP_009600051.1  67 RGKFSFEEEETIIHLHSILGNK-WSAIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.763961IPR017930Myb domain
SuperFamilySSF466891.35E-3111108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-171461IPR001005SANT/Myb domain
CDDcd001673.57E-121661No hitNo description
PROSITE profilePS5129425.26162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-2665116IPR009057Homeodomain-like
SMARTSM007172.2E-1566114IPR001005SANT/Myb domain
PfamPF002495.5E-1567111IPR001005SANT/Myb domain
CDDcd001675.76E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRPPCCDKN GLKKGPWTTE EDQKLIDYIQ KHGSGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SFEEEETIIH LHSILGNKWS AIAGRLPGRT DNEIKNYWNT HIRKKLLRMG  120
IDPVTHSPRL DLLDLTSIFN TSLYNSSQVN LSRLLGVQSL VNPEILKIAT SLFSSHHQNQ  180
NQNFLLPSNF QENQLCNSHV QNQLSQFVQT SQIQTPIQNI PSLPFYGEAQ VMQQPNVEQF  240
SSNISNFSSQ NCQLSEWQNF TFESLLSTLS TPSSSLTSLN SNSTCIKSSS TIISEEERES  300
YCSSMLNFDI SNGLDVNHDF F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
1mse_C2e-30121162105C-Myb DNA-Binding Domain
1msf_C2e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754498e-53HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600051.10.0PREDICTED: myb-related protein 308
TrEMBLK4CX781e-173K4CX78_SOLLC; Uncharacterized protein
STRINGSolyc10g005460.2.11e-172(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-112MYB-like 102